Anti WSCD2 pAb (ATL-HPA048133)

Atlas Antibodies

SKU:
ATL-HPA048133-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WSC domain containing 2
Gene Name: WSCD2
Alternative Gene Name: KIAA0789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063430: 90%, ENSRNOG00000053045: 89%
Entrez Gene ID: 9671
Uniprot ID: Q2TBF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EWPEFVRNYAPWWATHTLDWLKFGKKVLVVHFEDLKQDLFVQLGRMVSLLGVAVREDRLLCVESQKDGNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR
Gene Sequence EWPEFVRNYAPWWATHTLDWLKFGKKVLVVHFEDLKQDLFVQLGRMVSLLGVAVREDRLLCVESQKDGNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR
Gene ID - Mouse ENSMUSG00000063430
Gene ID - Rat ENSRNOG00000053045
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WSCD2 pAb (ATL-HPA048133)
Datasheet Anti WSCD2 pAb (ATL-HPA048133) Datasheet (External Link)
Vendor Page Anti WSCD2 pAb (ATL-HPA048133) at Atlas Antibodies

Documents & Links for Anti WSCD2 pAb (ATL-HPA048133)
Datasheet Anti WSCD2 pAb (ATL-HPA048133) Datasheet (External Link)
Vendor Page Anti WSCD2 pAb (ATL-HPA048133)