Anti WSB1 pAb (ATL-HPA003293)

Atlas Antibodies

Catalog No.:
ATL-HPA003293-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WD repeat and SOCS box containing 1
Gene Name: WSB1
Alternative Gene Name: DKFZp564A122, DKFZp564B0482, SWIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017677: 91%, ENSRNOG00000012929: 93%
Entrez Gene ID: 26118
Uniprot ID: Q9Y6I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDV
Gene Sequence APFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDV
Gene ID - Mouse ENSMUSG00000017677
Gene ID - Rat ENSRNOG00000012929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WSB1 pAb (ATL-HPA003293)
Datasheet Anti WSB1 pAb (ATL-HPA003293) Datasheet (External Link)
Vendor Page Anti WSB1 pAb (ATL-HPA003293) at Atlas Antibodies

Documents & Links for Anti WSB1 pAb (ATL-HPA003293)
Datasheet Anti WSB1 pAb (ATL-HPA003293) Datasheet (External Link)
Vendor Page Anti WSB1 pAb (ATL-HPA003293)
Citations for Anti WSB1 pAb (ATL-HPA003293) – 1 Found
Kim, Jung Jin; Lee, Seung Baek; Yi, Sang-Yeop; Han, Sang-Ah; Kim, Sun-Hyun; Lee, Jong-Min; Tong, Seo-Yun; Yin, Ping; Gao, Bowen; Zhang, Jun; Lou, Zhenkun. WSB1 overcomes oncogene-induced senescence by targeting ATM for degradation. Cell Research. 2017;27(2):274-293.  PubMed