Anti WNT8B pAb (ATL-HPA036570)

Atlas Antibodies

Catalog No.:
ATL-HPA036570-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: wingless-type MMTV integration site family, member 8B
Gene Name: WNT8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036961: 100%, ENSRNOG00000013817: 100%
Entrez Gene ID: 7479
Uniprot ID: Q93098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWER
Gene Sequence PEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWER
Gene ID - Mouse ENSMUSG00000036961
Gene ID - Rat ENSRNOG00000013817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WNT8B pAb (ATL-HPA036570)
Datasheet Anti WNT8B pAb (ATL-HPA036570) Datasheet (External Link)
Vendor Page Anti WNT8B pAb (ATL-HPA036570) at Atlas Antibodies

Documents & Links for Anti WNT8B pAb (ATL-HPA036570)
Datasheet Anti WNT8B pAb (ATL-HPA036570) Datasheet (External Link)
Vendor Page Anti WNT8B pAb (ATL-HPA036570)