Anti WNT7A pAb (ATL-HPA015719)

Atlas Antibodies

Catalog No.: ATL-HPA015719-25

Protein Description: wingless-type MMTV integration site family, member 7A
Gene Name: WNT7A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030093: 100%, ENSRNOG00000048782: 100%
Entrez Gene ID: 7476
Uniprot ID: O00755
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
• Gene Sequence: ILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
• Gene ID - Mouse: ENSMUSG00000030093
• Gene ID - Rat: ENSRNOG00000048782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WNT7A pAb (ATL-HPA015719) – 4 Found

Yoshioka, Shin; King, Mandy L; Ran, Sophia; Okuda, Hiroshi; MacLean, James A 2nd; McAsey, Mary E; Sugino, Norihiro; Brard, Laurent; Watabe, Kounosuke; Hayashi, Kanako. WNT7A regulates tumor growth and progression in ovarian cancer through the WNT/β-catenin pathway. Molecular Cancer Research : Mcr. 2012;10(3):469-82. 

Saben, J; Zhong, Y; McKelvey, S; Dajani, N K; Andres, A; Badger, T M; Gomez-Acevedo, H; Shankar, K. A comprehensive analysis of the human placenta transcriptome. Placenta. 2014;35(2):125-31. 

Itesako, Toshihiko; Seki, Naohiko; Yoshino, Hirofumi; Chiyomaru, Takeshi; Yamasaki, Takeshi; Hidaka, Hideo; Yonezawa, Tomokazu; Nohata, Nijiro; Kinoshita, Takashi; Nakagawa, Masayuki; Enokida, Hideki. The microRNA expression signature of bladder cancer by deep sequencing: the functional significance of the miR-195/497 cluster. Plos One. 9(2):e84311. 

Nawaz, Imran; Hu, Li-Fu; Du, Zi-Ming; Moumad, Khalid; Ignatyev, Ilya; Pavlova, Tatiana V; Kashuba, Vladimir; Almgren, Malin; Zabarovsky, Eugene R; Ernberg, Ingemar. Integrin α9 gene promoter is hypermethylated and downregulated in nasopharyngeal carcinoma. Oncotarget. 2015;6(31):31493-507.