Anti WNT2B pAb (ATL-HPA047274)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047274-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WNT2B
Alternative Gene Name: WNT13, XWNT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027840: 96%, ENSRNOG00000014385: 96%
Entrez Gene ID: 7482
Uniprot ID: Q93097
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF |
| Gene Sequence | TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF |
| Gene ID - Mouse | ENSMUSG00000027840 |
| Gene ID - Rat | ENSRNOG00000014385 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WNT2B pAb (ATL-HPA047274) | |
| Datasheet | Anti WNT2B pAb (ATL-HPA047274) Datasheet (External Link) |
| Vendor Page | Anti WNT2B pAb (ATL-HPA047274) at Atlas Antibodies |
| Documents & Links for Anti WNT2B pAb (ATL-HPA047274) | |
| Datasheet | Anti WNT2B pAb (ATL-HPA047274) Datasheet (External Link) |
| Vendor Page | Anti WNT2B pAb (ATL-HPA047274) |