Anti WNT2B pAb (ATL-HPA047274)

Atlas Antibodies

Catalog No.: ATL-HPA047274-25

Protein Description: Wnt family member 2B
Gene Name: WNT2B
Alternative Gene Name: WNT13, XWNT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027840: 96%, ENSRNOG00000014385: 96%
Entrez Gene ID: 7482
Uniprot ID: Q93097
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF
• Gene Sequence: TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF
• Gene ID - Mouse: ENSMUSG00000027840
• Gene ID - Rat: ENSRNOG00000014385
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.