Anti WNT2B pAb (ATL-HPA047274)

Atlas Antibodies

Catalog No.:
ATL-HPA047274-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Wnt family member 2B
Gene Name: WNT2B
Alternative Gene Name: WNT13, XWNT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027840: 96%, ENSRNOG00000014385: 96%
Entrez Gene ID: 7482
Uniprot ID: Q93097
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF
Gene Sequence TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF
Gene ID - Mouse ENSMUSG00000027840
Gene ID - Rat ENSRNOG00000014385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WNT2B pAb (ATL-HPA047274)
Datasheet Anti WNT2B pAb (ATL-HPA047274) Datasheet (External Link)
Vendor Page Anti WNT2B pAb (ATL-HPA047274) at Atlas Antibodies

Documents & Links for Anti WNT2B pAb (ATL-HPA047274)
Datasheet Anti WNT2B pAb (ATL-HPA047274) Datasheet (External Link)
Vendor Page Anti WNT2B pAb (ATL-HPA047274)