Anti WNT2B pAb (ATL-HPA047274)
Atlas Antibodies
- SKU:
- ATL-HPA047274-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: WNT2B
Alternative Gene Name: WNT13, XWNT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027840: 96%, ENSRNOG00000014385: 96%
Entrez Gene ID: 7482
Uniprot ID: Q93097
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF |
Gene Sequence | TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF |
Gene ID - Mouse | ENSMUSG00000027840 |
Gene ID - Rat | ENSRNOG00000014385 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WNT2B pAb (ATL-HPA047274) | |
Datasheet | Anti WNT2B pAb (ATL-HPA047274) Datasheet (External Link) |
Vendor Page | Anti WNT2B pAb (ATL-HPA047274) at Atlas Antibodies |
Documents & Links for Anti WNT2B pAb (ATL-HPA047274) | |
Datasheet | Anti WNT2B pAb (ATL-HPA047274) Datasheet (External Link) |
Vendor Page | Anti WNT2B pAb (ATL-HPA047274) |