Anti WNT16 pAb (ATL-HPA027030)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027030-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: WNT16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029671: 93%, ENSRNOG00000005781: 91%
Entrez Gene ID: 51384
Uniprot ID: Q9UBV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY |
| Gene Sequence | AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY |
| Gene ID - Mouse | ENSMUSG00000029671 |
| Gene ID - Rat | ENSRNOG00000005781 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WNT16 pAb (ATL-HPA027030) | |
| Datasheet | Anti WNT16 pAb (ATL-HPA027030) Datasheet (External Link) |
| Vendor Page | Anti WNT16 pAb (ATL-HPA027030) at Atlas Antibodies |
| Documents & Links for Anti WNT16 pAb (ATL-HPA027030) | |
| Datasheet | Anti WNT16 pAb (ATL-HPA027030) Datasheet (External Link) |
| Vendor Page | Anti WNT16 pAb (ATL-HPA027030) |