Anti WNT16 pAb (ATL-HPA027030)

Atlas Antibodies

Catalog No.: ATL-HPA027030-25

Protein Description: wingless-type MMTV integration site family, member 16
Gene Name: WNT16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029671: 93%, ENSRNOG00000005781: 91%
Entrez Gene ID: 51384
Uniprot ID: Q9UBV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY
• Gene Sequence: AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY
• Gene ID - Mouse: ENSMUSG00000029671
• Gene ID - Rat: ENSRNOG00000005781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.