Anti WDSUB1 pAb (ATL-HPA036840)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036840-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: WDSUB1
Alternative Gene Name: FLJ36175, UBOX6, WDSAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026988: 75%, ENSRNOG00000005990: 78%
Entrez Gene ID: 151525
Uniprot ID: Q8N9V3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTVLWNTENGQMLAVMEQPSGSPVRVCQFSPDSTCLASGAADGTVVLWNAQSYKLYRCGSVKDGSLAACAFSPNGSFFVTGSSCGDLTV |
| Gene Sequence | TTVLWNTENGQMLAVMEQPSGSPVRVCQFSPDSTCLASGAADGTVVLWNAQSYKLYRCGSVKDGSLAACAFSPNGSFFVTGSSCGDLTV |
| Gene ID - Mouse | ENSMUSG00000026988 |
| Gene ID - Rat | ENSRNOG00000005990 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WDSUB1 pAb (ATL-HPA036840) | |
| Datasheet | Anti WDSUB1 pAb (ATL-HPA036840) Datasheet (External Link) |
| Vendor Page | Anti WDSUB1 pAb (ATL-HPA036840) at Atlas Antibodies |
| Documents & Links for Anti WDSUB1 pAb (ATL-HPA036840) | |
| Datasheet | Anti WDSUB1 pAb (ATL-HPA036840) Datasheet (External Link) |
| Vendor Page | Anti WDSUB1 pAb (ATL-HPA036840) |