Anti WDR82 pAb (ATL-HPA040427)

Atlas Antibodies

Catalog No.: ATL-HPA040427-25

Protein Description: WD repeat domain 82
Gene Name: WDR82
Alternative Gene Name: MST107, MSTP107, PRO2730, PRO34047, SWD2, TMEM113, WDR82A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020257: 100%, ENSRNOG00000048441: 100%
Entrez Gene ID: 80335
Uniprot ID: Q6UXN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
• Gene Sequence: GYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
• Gene ID - Mouse: ENSMUSG00000020257
• Gene ID - Rat: ENSRNOG00000048441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.