Anti WDR64 pAb (ATL-HPA046186)

Atlas Antibodies

SKU:
ATL-HPA046186-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic  positivity in cells in seminiferous cells and Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 64
Gene Name: WDR64
Alternative Gene Name: FLJ32978
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026523: 75%, ENSRNOG00000038083: 74%
Entrez Gene ID: 128025
Uniprot ID: B1ANS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGLQVYQILEPHGFNTEVTSAAVDESGFLFATGAYNGTVRIWDFGSGQEMKVLPEGKDWKEDEHCLRRLIFLKAQE
Gene Sequence TGLQVYQILEPHGFNTEVTSAAVDESGFLFATGAYNGTVRIWDFGSGQEMKVLPEGKDWKEDEHCLRRLIFLKAQE
Gene ID - Mouse ENSMUSG00000026523
Gene ID - Rat ENSRNOG00000038083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDR64 pAb (ATL-HPA046186)
Datasheet Anti WDR64 pAb (ATL-HPA046186) Datasheet (External Link)
Vendor Page Anti WDR64 pAb (ATL-HPA046186) at Atlas Antibodies

Documents & Links for Anti WDR64 pAb (ATL-HPA046186)
Datasheet Anti WDR64 pAb (ATL-HPA046186) Datasheet (External Link)
Vendor Page Anti WDR64 pAb (ATL-HPA046186)