Anti WDR48 pAb (ATL-HPA038421 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038421-100

Protein Description: WD repeat domain 48
Gene Name: WDR48
Alternative Gene Name: KIAA1449, P80, SPG60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032512: 100%, ENSRNOG00000016942: 100%
Entrez Gene ID: 57599
Uniprot ID: Q8TAF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
• Gene Sequence: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
• Gene ID - Mouse: ENSMUSG00000032512
• Gene ID - Rat: ENSRNOG00000016942
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR48 pAb (ATL-HPA038421 w/enhanced validation) – 2 Found

Ohashi, Makoto; Holthaus, Amy M; Calderwood, Michael A; Lai, Chiou-Yan; Krastins, Bryan; Sarracino, David; Johannsen, Eric. The EBNA3 family of Epstein-Barr virus nuclear proteins associates with the USP46/USP12 deubiquitination complexes to regulate lymphoblastoid cell line growth. Plos Pathogens. 2015;11(4):e1004822. 

Raimondi, Marzia; Cesselli, Daniela; Di Loreto, Carla; La Marra, Francesco; Schneider, Claudio; Demarchi, Francesca. USP1 (ubiquitin specific peptidase 1) targets ULK1 and regulates its cellular compartmentalization and autophagy. Autophagy. 2019;15(4):613-630.