Anti WDR34 pAb (ATL-HPA040764)

Atlas Antibodies

Catalog No.: ATL-HPA040764-25

Protein Description: WD repeat domain 34
Gene Name: WDR34
Alternative Gene Name: bA216B9.3, DIC5, FAP133, MGC20486
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039715: 91%, ENSRNOG00000015636: 91%
Entrez Gene ID: 89891
Uniprot ID: Q96EX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKV
• Gene Sequence: APPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKV
• Gene ID - Mouse: ENSMUSG00000039715
• Gene ID - Rat: ENSRNOG00000015636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR34 pAb (ATL-HPA040764) – 1 Found

Asante, David; Maccarthy-Morrogh, Lucy; Townley, Anna K; Weiss, Matthew A; Katayama, Kentaro; Palmer, Krysten J; Suzuki, Hiroetsu; Westlake, Chris J; Stephens, David J. A role for the Golgi matrix protein giantin in ciliogenesis through control of the localization of dynein-2. Journal Of Cell Science. 2013;126(Pt 22):5189-97.