Anti WDR27 pAb (ATL-HPA037497)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037497-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WDR27
Alternative Gene Name: MGC43690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046991: 53%, ENSRNOG00000015609: 54%
Entrez Gene ID: 253769
Uniprot ID: A2RRH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SCALRNRTADQKVLCLLASLFGGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLYLGIAKEKSTKAASEQRRAARNVMKDQR |
| Gene Sequence | SCALRNRTADQKVLCLLASLFGGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLYLGIAKEKSTKAASEQRRAARNVMKDQR |
| Gene ID - Mouse | ENSMUSG00000046991 |
| Gene ID - Rat | ENSRNOG00000015609 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WDR27 pAb (ATL-HPA037497) | |
| Datasheet | Anti WDR27 pAb (ATL-HPA037497) Datasheet (External Link) |
| Vendor Page | Anti WDR27 pAb (ATL-HPA037497) at Atlas Antibodies |
| Documents & Links for Anti WDR27 pAb (ATL-HPA037497) | |
| Datasheet | Anti WDR27 pAb (ATL-HPA037497) Datasheet (External Link) |
| Vendor Page | Anti WDR27 pAb (ATL-HPA037497) |