Anti WDR27 pAb (ATL-HPA037497)

Atlas Antibodies

Catalog No.:
ATL-HPA037497-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 27
Gene Name: WDR27
Alternative Gene Name: MGC43690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046991: 53%, ENSRNOG00000015609: 54%
Entrez Gene ID: 253769
Uniprot ID: A2RRH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCALRNRTADQKVLCLLASLFGGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLYLGIAKEKSTKAASEQRRAARNVMKDQR
Gene Sequence SCALRNRTADQKVLCLLASLFGGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLYLGIAKEKSTKAASEQRRAARNVMKDQR
Gene ID - Mouse ENSMUSG00000046991
Gene ID - Rat ENSRNOG00000015609
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR27 pAb (ATL-HPA037497)
Datasheet Anti WDR27 pAb (ATL-HPA037497) Datasheet (External Link)
Vendor Page Anti WDR27 pAb (ATL-HPA037497) at Atlas Antibodies

Documents & Links for Anti WDR27 pAb (ATL-HPA037497)
Datasheet Anti WDR27 pAb (ATL-HPA037497) Datasheet (External Link)
Vendor Page Anti WDR27 pAb (ATL-HPA037497)