Anti WDHD1 pAb (ATL-HPA001122 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001122-25

Protein Description: WD repeat and HMG-box DNA binding protein 1
Gene Name: WDHD1
Alternative Gene Name: AND-1, CHTF4, CTF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037572: 90%, ENSRNOG00000011167: 86%
Entrez Gene ID: 11169
Uniprot ID: O75717
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
• Gene Sequence: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
• Gene ID - Mouse: ENSMUSG00000037572
• Gene ID - Rat: ENSRNOG00000011167
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDHD1 pAb (ATL-HPA001122 w/enhanced validation) – 2 Found

Sato, Nagato; Koinuma, Junkichi; Fujita, Masahiro; Hosokawa, Masao; Ito, Tomoo; Tsuchiya, Eiju; Kondo, Satoshi; Nakamura, Yusuke; Daigo, Yataro. Activation of WD repeat and high-mobility group box DNA binding protein 1 in pulmonary and esophageal carcinogenesis. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2010;16(1):226-39. 

Ertay, Ayse; Liu, Huiquan; Liu, Dian; Peng, Ping; Hill, Charlotte; Xiong, Hua; Hancock, David; Yuan, Xianglin; Przewloka, Marcin R; Coldwell, Mark; Howell, Michael; Skipp, Paul; Ewing, Rob M; Downward, Julian; Wang, Yihua. WDHD1 is essential for the survival of PTEN-inactive triple-negative breast cancer. Cell Death & Disease. 2020;11(11):1001.