Anti WBSCR17 pAb (ATL-HPA013624)

Atlas Antibodies

Catalog No.: ATL-HPA013624-25

Protein Description: Williams-Beuren syndrome chromosome region 17
Gene Name: WBSCR17
Alternative Gene Name: GalNAc-T5L, GALNTL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034040: 99%, ENSRNOG00000024435: 99%
Entrez Gene ID: 64409
Uniprot ID: Q6IS24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE
• Gene Sequence: RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE
• Gene ID - Mouse: ENSMUSG00000034040
• Gene ID - Rat: ENSRNOG00000024435
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.