Anti WBP11 pAb (ATL-HPA046403)

Atlas Antibodies

Catalog No.:
ATL-HPA046403-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WW domain binding protein 11
Gene Name: WBP11
Alternative Gene Name: NPWBP, PPP1R165, SIPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030216: 86%, ENSRNOG00000049593: 86%
Entrez Gene ID: 51729
Uniprot ID: Q9Y2W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME
Gene Sequence QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME
Gene ID - Mouse ENSMUSG00000030216
Gene ID - Rat ENSRNOG00000049593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WBP11 pAb (ATL-HPA046403)
Datasheet Anti WBP11 pAb (ATL-HPA046403) Datasheet (External Link)
Vendor Page Anti WBP11 pAb (ATL-HPA046403) at Atlas Antibodies

Documents & Links for Anti WBP11 pAb (ATL-HPA046403)
Datasheet Anti WBP11 pAb (ATL-HPA046403) Datasheet (External Link)
Vendor Page Anti WBP11 pAb (ATL-HPA046403)