Anti WBP11 pAb (ATL-HPA046403)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046403-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: WBP11
Alternative Gene Name: NPWBP, PPP1R165, SIPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030216: 86%, ENSRNOG00000049593: 86%
Entrez Gene ID: 51729
Uniprot ID: Q9Y2W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME |
Gene Sequence | QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME |
Gene ID - Mouse | ENSMUSG00000030216 |
Gene ID - Rat | ENSRNOG00000049593 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WBP11 pAb (ATL-HPA046403) | |
Datasheet | Anti WBP11 pAb (ATL-HPA046403) Datasheet (External Link) |
Vendor Page | Anti WBP11 pAb (ATL-HPA046403) at Atlas Antibodies |
Documents & Links for Anti WBP11 pAb (ATL-HPA046403) | |
Datasheet | Anti WBP11 pAb (ATL-HPA046403) Datasheet (External Link) |
Vendor Page | Anti WBP11 pAb (ATL-HPA046403) |