Anti WASHC3 pAb (ATL-HPA038338)

Atlas Antibodies

Catalog No.:
ATL-HPA038338-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WASH complex subunit 3
Gene Name: WASHC3
Alternative Gene Name: CCDC53, CGI-116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020056: 98%, ENSRNOG00000005102: 95%
Entrez Gene ID: 51019
Uniprot ID: Q9Y3C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSP
Gene Sequence LMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSP
Gene ID - Mouse ENSMUSG00000020056
Gene ID - Rat ENSRNOG00000005102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WASHC3 pAb (ATL-HPA038338)
Datasheet Anti WASHC3 pAb (ATL-HPA038338) Datasheet (External Link)
Vendor Page Anti WASHC3 pAb (ATL-HPA038338) at Atlas Antibodies

Documents & Links for Anti WASHC3 pAb (ATL-HPA038338)
Datasheet Anti WASHC3 pAb (ATL-HPA038338) Datasheet (External Link)
Vendor Page Anti WASHC3 pAb (ATL-HPA038338)