Anti WASHC3 pAb (ATL-HPA038338)

Atlas Antibodies

Catalog No.: ATL-HPA038338-25

Protein Description: WASH complex subunit 3
Gene Name: WASHC3
Alternative Gene Name: CCDC53, CGI-116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020056: 98%, ENSRNOG00000005102: 95%
Entrez Gene ID: 51019
Uniprot ID: Q9Y3C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSP
• Gene Sequence: LMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSP
• Gene ID - Mouse: ENSMUSG00000020056
• Gene ID - Rat: ENSRNOG00000005102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.