Anti WARS2 pAb (ATL-HPA028007)

Atlas Antibodies

Catalog No.: ATL-HPA028007-25

Protein Description: tryptophanyl tRNA synthetase 2, mitochondrial
Gene Name: WARS2
Alternative Gene Name: TrpRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004233: 80%, ENSRNOG00000019508: 80%
Entrez Gene ID: 10352
Uniprot ID: Q9UGM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG
• Gene Sequence: VSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG
• Gene ID - Mouse: ENSMUSG00000004233
• Gene ID - Rat: ENSRNOG00000019508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.