Anti WAC pAb (ATL-HPA042609)

Atlas Antibodies

Catalog No.: ATL-HPA042609-25

Protein Description: WW domain containing adaptor with coiled-coil
Gene Name: WAC
Alternative Gene Name: BM-016, FLJ31290, MGC10753, PRO1741, Wwp4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024283: 89%, ENSRNOG00000018698: 88%
Entrez Gene ID: 51322
Uniprot ID: Q9BTA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NATVVPQNSSARSTCSLTPALAAHFSENLIKHVQGWPADHAEKQASRLREEAHNMGTIHMSEICTELKNLRSLVRVCEIQATLR
• Gene Sequence: NATVVPQNSSARSTCSLTPALAAHFSENLIKHVQGWPADHAEKQASRLREEAHNMGTIHMSEICTELKNLRSLVRVCEIQATLR
• Gene ID - Mouse: ENSMUSG00000024283
• Gene ID - Rat: ENSRNOG00000018698
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.