Anti VWA8 pAb (ATL-HPA045478)

Atlas Antibodies

SKU:
ATL-HPA045478-25
  • Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: von Willebrand factor A domain containing 8
Gene Name: VWA8
Alternative Gene Name: KIAA0564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058997: 69%, ENSRNOG00000033722: 20%
Entrez Gene ID: 23078
Uniprot ID: A3KMH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYWTIGQARSGMQKLLCPVETHHIDIKGPALINIQEYPIERHEERSLNFTEECASWRIPLDEINIICDIATSHENEQNTLYVVTCNPASLYFMNMT
Gene Sequence GYWTIGQARSGMQKLLCPVETHHIDIKGPALINIQEYPIERHEERSLNFTEECASWRIPLDEINIICDIATSHENEQNTLYVVTCNPASLYFMNMT
Gene ID - Mouse ENSMUSG00000058997
Gene ID - Rat ENSRNOG00000033722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti VWA8 pAb (ATL-HPA045478)
Datasheet Anti VWA8 pAb (ATL-HPA045478) Datasheet (External Link)
Vendor Page Anti VWA8 pAb (ATL-HPA045478) at Atlas Antibodies

Documents & Links for Anti VWA8 pAb (ATL-HPA045478)
Datasheet Anti VWA8 pAb (ATL-HPA045478) Datasheet (External Link)
Vendor Page Anti VWA8 pAb (ATL-HPA045478)