Anti VTA1 pAb (ATL-HPA030969 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030969-100

Protein Description: vesicle (multivesicular body) trafficking 1
Gene Name: VTA1
Alternative Gene Name: C6orf55, HSPC228, My012
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019868: 84%, ENSRNOG00000011540: 87%
Entrez Gene ID: 51534
Uniprot ID: Q9NP79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAE
• Gene Sequence: NGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAE
• Gene ID - Mouse: ENSMUSG00000019868
• Gene ID - Rat: ENSRNOG00000011540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.