Anti VSX2 pAb (ATL-HPA003436 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003436-25

Protein Description: visual system homeobox 2
Gene Name: VSX2
Alternative Gene Name: CHX10, HOX10, RET1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021239: 99%, ENSRNOG00000011918: 99%
Entrez Gene ID: 338917
Uniprot ID: P58304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
• Gene Sequence: LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
• Gene ID - Mouse: ENSMUSG00000021239
• Gene ID - Rat: ENSRNOG00000011918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VSX2 pAb (ATL-HPA003436 w/enhanced validation) – 4 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Bejjani, Anthony; Choi, Mee Rim; Cassidy, Linda; Collins, David W; O'Brien, Joan M; Murray, Tim; Ksander, Bruce R; Seigel, Gail M. RB116: an RB1+ retinoblastoma cell line expressing primitive markers. Molecular Vision. 18( 23233783):2805-13. 

Zeng, Yuxiao; Li, Minghui; Zou, Ting; Chen, Xi; Li, Qiyou; Li, Yijian; Ge, Lingling; Chen, Siyu; Xu, Haiwei. The Impact of Particulate Matter (PM2.5) on Human Retinal Development in hESC-Derived Retinal Organoids. Frontiers In Cell And Developmental Biology. 9( 33644046):607341. 

Li, Jinying; Qiu, Chen; Zhou, Jiayi; Wei, Yang; Yuan, Weixin; Liu, Jia; Cui, Wenyu; Huang, Jianan; Qiu, Cong; Guo, Lihe; Yu, Luyang; Ge, Zhen. Repair of Retinal Degeneration by Human Amniotic Epithelial Stem Cell-Derived Photoreceptor-like Cells. International Journal Of Molecular Sciences. 2022;23(15)