Anti VSIR pAb (ATL-HPA007968 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007968-25

Protein Description: V-set immunoregulatory receptor
Gene Name: VSIR
Alternative Gene Name: B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020101: 60%, ENSRNOG00000000569: 59%
Entrez Gene ID: 64115
Uniprot ID: Q9H7M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
• Gene Sequence: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
• Gene ID - Mouse: ENSMUSG00000020101
• Gene ID - Rat: ENSRNOG00000000569
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VSIR pAb (ATL-HPA007968 w/enhanced validation) – 2 Found

Mulati, Kumuluzi; Hamanishi, Junzo; Matsumura, Noriomi; Chamoto, Kenji; Mise, Nathan; Abiko, Kaoru; Baba, Tsukasa; Yamaguchi, Ken; Horikawa, Naoki; Murakami, Ryusuke; Taki, Mana; Budiman, Kharma; Zeng, Xiang; Hosoe, Yuko; Azuma, Miyuki; Konishi, Ikuo; Mandai, Masaki. VISTA expressed in tumour cells regulates T cell function. British Journal Of Cancer. 2019;120(1):115-127. 

Croft, Priyakshi Kalita-de; Chittoory, Haarika; Nguyen, Tam H; Saunus, Jodi M; Kim, Woo Gyeong; McCart Reed, Amy E; Lim, Malcolm; De Luca, Xavier M; Ferguson, Kaltin; Niland, Colleen; Mazzieri, Roberta; Dolcetti, Riccardo; Simpson, Peter T; Lakhani, Sunil R. Characterization of Immune Cell Subsets of Tumor Infiltrating Lymphocytes in Brain Metastases. Biology. 2021;10(5)