Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000660-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: vaccinia related kinase 1
Gene Name: VRK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021115: 90%, ENSRNOG00000005274: 92%
Entrez Gene ID: 7443
Uniprot ID: Q99986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKI
Gene Sequence KAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKI
Gene ID - Mouse ENSMUSG00000021115
Gene ID - Rat ENSRNOG00000005274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation)
Datasheet Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation)
Datasheet Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation)
Citations for Anti VRK1 pAb (ATL-HPA000660 w/enhanced validation) – 13 Found
Vinograd-Byk, Hadar; Sapir, Tamar; Cantarero, Lara; Lazo, Pedro A; Zeligson, Sharon; Lev, Dorit; Lerman-Sagie, Tally; Renbaum, Paul; Reiner, Orly; Levy-Lahad, Ephrat. The spinal muscular atrophy with pontocerebellar hypoplasia gene VRK1 regulates neuronal migration through an amyloid-β precursor protein-dependent mechanism. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2015;35(3):936-42.  PubMed
Moura, David S; Fernández, Isabel F; Marín-Royo, Gema; López-Sánchez, Inmaculada; Martín-Doncel, Elena; Vega, Francisco M; Lazo, Pedro A. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific Reports. 2016;6( 27334688):28532.  PubMed
Birendra Kc; May, Danielle G; Benson, Benjamin V; Kim, Dae In; Shivega, Winnie G; Ali, Manaal H; Faustino, Randolph S; Campos, Alexandre R; Roux, Kyle J. VRK2A is an A-type lamin-dependent nuclear envelope kinase that phosphorylates BAF. Molecular Biology Of The Cell. 2017;28(17):2241-2250.  PubMed
Moura, David S; Campillo-Marcos, Ignacio; Vázquez-Cedeira, Marta; Lazo, Pedro A. VRK1 and AURKB form a complex that cross inhibit their kinase activity and the phosphorylation of histone H3 in the progression of mitosis. Cellular And Molecular Life Sciences : Cmls. 2018;75(14):2591-2611.  PubMed
Sanz-García, Marta; Monsalve, Diana M; Sevilla, Ana; Lazo, Pedro A. Vaccinia-related kinase 1 (VRK1) is an upstream nucleosomal kinase required for the assembly of 53BP1 foci in response to ionizing radiation-induced DNA damage. The Journal Of Biological Chemistry. 2012;287(28):23757-68.  PubMed
Kim, Il-Jin; Quigley, David; To, Minh D; Pham, Patrick; Lin, Kevin; Jo, Brian; Jen, Kuang-Yu; Raz, Dan; Kim, Jae; Mao, Jian-Hua; Jablons, David; Balmain, Allan. Rewiring of human lung cell lineage and mitotic networks in lung adenocarcinomas. Nature Communications. 4( 23591868):1701.  PubMed
Molitor, T P; Traktman, P. Molecular genetic analysis of VRK1 in mammary epithelial cells: depletion slows proliferation in vitro and tumor growth and metastasis in vivo. Oncogenesis. 2013;2(6):e48.  PubMed
Molitor, Tyler P; Traktman, Paula. Depletion of the protein kinase VRK1 disrupts nuclear envelope morphology and leads to BAF retention on mitotic chromosomes. Molecular Biology Of The Cell. 2014;25(6):891-903.  PubMed
Salzano, Marcella; Vázquez-Cedeira, Marta; Sanz-García, Marta; Valbuena, Alberto; Blanco, Sandra; Fernández, Isabel F; Lazo, Pedro A. Vaccinia-related kinase 1 (VRK1) confers resistance to DNA-damaging agents in human breast cancer by affecting DNA damage response. Oncotarget. 2014;5(7):1770-8.  PubMed
Cantarero, Lara; Sanz-García, Marta; Vinograd-Byk, Hadar; Renbaum, Paul; Levy-Lahad, Ephrat; Lazo, Pedro A. VRK1 regulates Cajal body dynamics and protects coilin from proteasomal degradation in cell cycle. Scientific Reports. 2015;5( 26068304):10543.  PubMed
Campillo-Marcos, Ignacio; Lazo, Pedro A. Olaparib and ionizing radiation trigger a cooperative DNA-damage repair response that is impaired by depletion of the VRK1 chromatin kinase. Journal Of Experimental & Clinical Cancer Research : Cr. 2019;38(1):203.  PubMed
Navarro-Carrasco, Elena; Lazo, Pedro A. VRK1 Depletion Facilitates the Synthetic Lethality of Temozolomide and Olaparib in Glioblastoma Cells. Frontiers In Cell And Developmental Biology. 9( 34195200):683038.  PubMed
Gómez-Muñoz, María A; Aguilar-Morante, Diana; Colmenero-Repiso, Ana; Amador-Álvarez, Aida; Ojeda-Puertas, Mónica; Cordero Varela, Juan Antonio; Rodríguez-Prieto, Ismael; Pardal, Ricardo; Vega, Francisco M. Analysis of Serial Neuroblastoma PDX Passages in Mice Allows the Identification of New Mediators of Neuroblastoma Aggressiveness. International Journal Of Molecular Sciences. 2023;24(2)  PubMed