Anti VPS37A pAb (ATL-HPA024705)

Atlas Antibodies

Catalog No.: ATL-HPA024705-25

Protein Description: vacuolar protein sorting 37 homolog A (S. cerevisiae)
Gene Name: VPS37A
Alternative Gene Name: FLJ32642, HCRP1, PQBP2, SPG53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031600: 92%, ENSRNOG00000012001: 92%
Entrez Gene ID: 137492
Uniprot ID: Q8NEZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
• Gene Sequence: DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
• Gene ID - Mouse: ENSMUSG00000031600
• Gene ID - Rat: ENSRNOG00000012001
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.