Anti VPS37A pAb (ATL-HPA024705)

Atlas Antibodies

Catalog No.:
ATL-HPA024705-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 37 homolog A (S. cerevisiae)
Gene Name: VPS37A
Alternative Gene Name: FLJ32642, HCRP1, PQBP2, SPG53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031600: 92%, ENSRNOG00000012001: 92%
Entrez Gene ID: 137492
Uniprot ID: Q8NEZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
Gene Sequence DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
Gene ID - Mouse ENSMUSG00000031600
Gene ID - Rat ENSRNOG00000012001
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS37A pAb (ATL-HPA024705)
Datasheet Anti VPS37A pAb (ATL-HPA024705) Datasheet (External Link)
Vendor Page Anti VPS37A pAb (ATL-HPA024705) at Atlas Antibodies

Documents & Links for Anti VPS37A pAb (ATL-HPA024705)
Datasheet Anti VPS37A pAb (ATL-HPA024705) Datasheet (External Link)
Vendor Page Anti VPS37A pAb (ATL-HPA024705)