Anti VPS36 pAb (ATL-HPA043947)

Atlas Antibodies

Catalog No.:
ATL-HPA043947-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 36 homolog (S. cerevisiae)
Gene Name: VPS36
Alternative Gene Name: C13orf9, CGI-145, Eap45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031479: 97%, ENSRNOG00000012654: 97%
Entrez Gene ID: 51028
Uniprot ID: Q86VN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACK
Gene Sequence KDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACK
Gene ID - Mouse ENSMUSG00000031479
Gene ID - Rat ENSRNOG00000012654
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS36 pAb (ATL-HPA043947)
Datasheet Anti VPS36 pAb (ATL-HPA043947) Datasheet (External Link)
Vendor Page Anti VPS36 pAb (ATL-HPA043947) at Atlas Antibodies

Documents & Links for Anti VPS36 pAb (ATL-HPA043947)
Datasheet Anti VPS36 pAb (ATL-HPA043947) Datasheet (External Link)
Vendor Page Anti VPS36 pAb (ATL-HPA043947)