Anti VPS36 pAb (ATL-HPA043947)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043947-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: VPS36
Alternative Gene Name: C13orf9, CGI-145, Eap45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031479: 97%, ENSRNOG00000012654: 97%
Entrez Gene ID: 51028
Uniprot ID: Q86VN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACK |
| Gene Sequence | KDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACK |
| Gene ID - Mouse | ENSMUSG00000031479 |
| Gene ID - Rat | ENSRNOG00000012654 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS36 pAb (ATL-HPA043947) | |
| Datasheet | Anti VPS36 pAb (ATL-HPA043947) Datasheet (External Link) |
| Vendor Page | Anti VPS36 pAb (ATL-HPA043947) at Atlas Antibodies |
| Documents & Links for Anti VPS36 pAb (ATL-HPA043947) | |
| Datasheet | Anti VPS36 pAb (ATL-HPA043947) Datasheet (External Link) |
| Vendor Page | Anti VPS36 pAb (ATL-HPA043947) |