Anti VPS13A pAb (ATL-HPA021662)

Atlas Antibodies

Catalog No.:
ATL-HPA021662-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 13 homolog A (S. cerevisiae)
Gene Name: VPS13A
Alternative Gene Name: CHAC, KIAA0986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046230: 97%, ENSRNOG00000030213: 34%
Entrez Gene ID: 23230
Uniprot ID: Q96RL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
Gene Sequence RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
Gene ID - Mouse ENSMUSG00000046230
Gene ID - Rat ENSRNOG00000030213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS13A pAb (ATL-HPA021662)
Datasheet Anti VPS13A pAb (ATL-HPA021662) Datasheet (External Link)
Vendor Page Anti VPS13A pAb (ATL-HPA021662) at Atlas Antibodies

Documents & Links for Anti VPS13A pAb (ATL-HPA021662)
Datasheet Anti VPS13A pAb (ATL-HPA021662) Datasheet (External Link)
Vendor Page Anti VPS13A pAb (ATL-HPA021662)
Citations for Anti VPS13A pAb (ATL-HPA021662) – 4 Found
Vonk, Jan J; Yeshaw, Wondwossen M; Pinto, Francesco; Faber, Anita I E; Lahaye, Liza L; Kanon, Bart; van der Zwaag, Marianne; Velayos-Baeza, Antonio; Freire, Raimundo; van IJzendoorn, Sven C; Grzeschik, Nicola A; Sibon, Ody C M. Drosophila Vps13 Is Required for Protein Homeostasis in the Brain. Plos One. 12(1):e0170106.  PubMed
Muñoz-Braceras, Sandra; Tornero-Écija, Alba R; Vincent, Olivier; Escalante, Ricardo. VPS13A is closely associated with mitochondria and is required for efficient lysosomal degradation. Disease Models & Mechanisms. 2019;12(2)  PubMed
Urata, Yuka; Nakamura, Masayuki; Sasaki, Natsuki; Shiokawa, Nari; Nishida, Yoshiaki; Arai, Kaoru; Hiwatashi, Hanae; Yokoyama, Izumi; Narumi, Shinsuke; Terayama, Yasuo; Murakami, Takenobu; Ugawa, Yoshikazu; Sakamoto, Hiroki; Kaneko, Satoshi; Nakazawa, Yusuke; Yamasaki, Ryo; Sadashima, Shoko; Sakai, Toshiaki; Arai, Hiroaki; Sano, Akira. Novel pathogenic XK mutations in McLeod syndrome and interaction between XK protein and chorein. Neurology. Genetics. 2019;5(3):e328.  PubMed
Yeshaw, Wondwossen M; van der Zwaag, Marianne; Pinto, Francesco; Lahaye, Liza L; Faber, Anita Ie; Gómez-Sánchez, Rubén; Dolga, Amalia M; Poland, Conor; Monaco, Anthony P; van IJzendoorn, Sven Cd; Grzeschik, Nicola A; Velayos-Baeza, Antonio; Sibon, Ody Cm. Human VPS13A is associated with multiple organelles and influences mitochondrial morphology and lipid droplet motility. Elife. 2019;8( 30741634)  PubMed