Anti VCPIP1 pAb (ATL-HPA023932)

Atlas Antibodies

Catalog No.: ATL-HPA023932-25

Protein Description: valosin containing protein (p97)/p47 complex interacting protein 1
Gene Name: VCPIP1
Alternative Gene Name: DUBA3, FLJ23132, KIAA1850, VCIP135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045210: 92%, ENSRNOG00000006980: 95%
Entrez Gene ID: 80124
Uniprot ID: Q96JH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLCGALSELHVPPEWLAPGGKLYNLAKSTHGQLRTDKNYSFPLNNLVCSYDSVKDVLVPDYGMSNLTACNWCHGTSVRKVRGDGSIVYLDG
• Gene Sequence: LLCGALSELHVPPEWLAPGGKLYNLAKSTHGQLRTDKNYSFPLNNLVCSYDSVKDVLVPDYGMSNLTACNWCHGTSVRKVRGDGSIVYLDG
• Gene ID - Mouse: ENSMUSG00000045210
• Gene ID - Rat: ENSRNOG00000006980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.