Anti VCP pAb (ATL-HPA012728 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012728-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: VCP
Alternative Gene Name: IBMPFD, p97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028452: 100%, ENSRNOG00000034242: 100%
Entrez Gene ID: 7415
Uniprot ID: P55072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVE |
| Gene Sequence | LSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVE |
| Gene ID - Mouse | ENSMUSG00000028452 |
| Gene ID - Rat | ENSRNOG00000034242 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VCP pAb (ATL-HPA012728 w/enhanced validation) | |
| Datasheet | Anti VCP pAb (ATL-HPA012728 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VCP pAb (ATL-HPA012728 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti VCP pAb (ATL-HPA012728 w/enhanced validation) | |
| Datasheet | Anti VCP pAb (ATL-HPA012728 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VCP pAb (ATL-HPA012728 w/enhanced validation) |