Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA034796-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: vascular cell adhesion molecule 1
Gene Name: VCAM1
Alternative Gene Name: CD106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027962: 72%, ENSRNOG00000014333: 75%
Entrez Gene ID: 7412
Uniprot ID: P19320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSG
Gene Sequence IGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSG
Gene ID - Mouse ENSMUSG00000027962
Gene ID - Rat ENSRNOG00000014333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation)
Datasheet Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation)
Datasheet Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation)
Citations for Anti VCAM1 pAb (ATL-HPA034796 w/enhanced validation) – 1 Found
Akbar, Moeed; McLean, Michael; Garcia-Melchor, Emma; Crowe, Lindsay An; McMillan, Paul; Fazzi, Umberto G; Martin, David; Arthur, Angus; Reilly, James H; McInnes, Iain B; Millar, Neal L. Fibroblast activation and inflammation in frozen shoulder. Plos One. 14(4):e0215301.  PubMed