Anti VASP pAb (ATL-HPA005724 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA005724-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: vasodilator-stimulated phosphoprotein
Gene Name: VASP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030403: 85%, ENSRNOG00000016367: 82%
Entrez Gene ID: 7408
Uniprot ID: P50552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
Gene Sequence PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
Gene ID - Mouse ENSMUSG00000030403
Gene ID - Rat ENSRNOG00000016367
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VASP pAb (ATL-HPA005724 w/enhanced validation)
Datasheet Anti VASP pAb (ATL-HPA005724 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VASP pAb (ATL-HPA005724 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VASP pAb (ATL-HPA005724 w/enhanced validation)
Datasheet Anti VASP pAb (ATL-HPA005724 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VASP pAb (ATL-HPA005724 w/enhanced validation)
Citations for Anti VASP pAb (ATL-HPA005724 w/enhanced validation) – 4 Found
Tojkander, Sari; Gateva, Gergana; Husain, Amjad; Krishnan, Ramaswamy; Lappalainen, Pekka. Generation of contractile actomyosin bundles depends on mechanosensitive actin filament assembly and disassembly. Elife. 2015;4( 26652273):e06126.  PubMed
Waldman, Monique M; Rahkola, Jeremy T; Sigler, Ashton L; Chung, Jeffrey W; Willett, Benjamin A S; Kedl, Ross M; Friedman, Rachel S; Jacobelli, Jordan. Ena/VASP Protein-Mediated Actin Polymerization Contributes to Naïve CD8(+) T Cell Activation and Expansion by Promoting T Cell-APC Interactions In Vivo. Frontiers In Immunology. 13( 35757762):856977.  PubMed
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed
Fäßler, Florian; Javoor, Manjunath G; Datler, Julia; Döring, Hermann; Hofer, Florian W; Dimchev, Georgi; Hodirnau, Victor-Valentin; Faix, Jan; Rottner, Klemens; Schur, Florian K M. ArpC5 isoforms regulate Arp2/3 complex-dependent protrusion through differential Ena/VASP positioning. Science Advances. 2023;9(3):eadd6495.  PubMed