Anti VAPB pAb (ATL-HPA013144 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA013144-25

Protein Description: VAMP (vesicle-associated membrane protein)-associated protein B and C
Gene Name: VAPB
Alternative Gene Name: ALS8, VAP-B, VAP-C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054455: 82%, ENSRNOG00000005331: 79%
Entrez Gene ID: 9217
Uniprot ID: O95292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGK
• Gene Sequence: VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGK
• Gene ID - Mouse: ENSMUSG00000054455
• Gene ID - Rat: ENSRNOG00000005331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VAPB pAb (ATL-HPA013144 w/enhanced validation) – 10 Found

Wang, Yunhong; Metz, Jeremy; Costello, Joseph L; Passmore, Josiah; Schrader, Michael; Schultz, Christian; Islinger, Markus. Intracellular redistribution of neuronal peroxisomes in response to ACBD5 expression. Plos One. 13(12):e0209507. 

Federspiel, Joel D; Cook, Katelyn C; Kennedy, Michelle A; Venkatesh, Samvida S; Otter, Clayton J; Hofstadter, William A; Jean Beltran, Pierre M; Cristea, Ileana M. Mitochondria and Peroxisome Remodeling across Cytomegalovirus Infection Time Viewed through the Lens of Inter-ViSTA. Cell Reports. 2020;32(4):107943. 

Riccio, Victoria; Demers, Nicholas; Hua, Rong; Vissa, Miluska; Cheng, Derrick T; Strilchuk, Amy Wong; Wang, Yuqing; McQuibban, G Angus; Kim, Peter Kijun. Deubiquitinating enzyme USP30 maintains basal peroxisome abundance by regulating pexophagy. The Journal Of Cell Biology. 2019;218(3):798-807. 

Yeshaw, Wondwossen M; van der Zwaag, Marianne; Pinto, Francesco; Lahaye, Liza L; Faber, Anita Ie; Gómez-Sánchez, Rubén; Dolga, Amalia M; Poland, Conor; Monaco, Anthony P; van IJzendoorn, Sven Cd; Grzeschik, Nicola A; Velayos-Baeza, Antonio; Sibon, Ody Cm. Human VPS13A is associated with multiple organelles and influences mitochondrial morphology and lipid droplet motility. Elife. 2019;8( 30741634) 

Gao, Junjie; Qin, An; Liu, Delin; Ruan, Rui; Wang, Qiyang; Yuan, Jun; Cheng, Tak Sum; Filipovska, Aleksandra; Papadimitriou, J M; Dai, Kerong; Jiang, Qing; Gao, Xiang; Feng, Jian Q; Takayanagi, Hiroshi; Zhang, Changqing; Zheng, Ming H. Endoplasmic reticulum mediates mitochondrial transfer within the osteocyte dendritic network. Science Advances. 2019;5(11):eaaw7215. 

Boutry, Maxime; Kim, Peter K. ORP1L mediated PI(4)P signaling at ER-lysosome-mitochondrion three-way contact contributes to mitochondrial division. Nature Communications. 2021;12(1):5354. 

Saffi, Golam T; Tang, Evan; Mamand, Sami; Inpanathan, Subothan; Fountain, Aaron; Salmena, Leonardo; Botelho, Roberto J. Reactive oxygen species prevent lysosome coalescence during PIKfyve inhibition. Plos One. 16(11):e0259313. 

Maxson, Michelle E; Abbas, Yazan M; Wu, Jing Ze; Plumb, Jonathan D; Grinstein, Sergio; Rubinstein, John L. Detection and quantification of the vacuolar H+ATPase using the Legionella effector protein SidK. The Journal Of Cell Biology. 2022;221(3) 

Levin-Konigsberg, Roni; Montaño-Rendón, Fernando; Keren-Kaplan, Tal; Li, Ren; Ego, Braeden; Mylvaganam, Sivakami; DiCiccio, Jessica E; Trimble, William S; Bassik, Michael C; Bonifacino, Juan S; Fairn, Gregory D; Grinstein, Sergio. Phagolysosome resolution requires contacts with the endoplasmic reticulum and phosphatidylinositol-4-phosphate signalling. Nature Cell Biology. 2019;21(10):1234-1247. 

Mori, Fumiaki; Miki, Yasuo; Tanji, Kunikazu; Kon, Tomoya; Tomiyama, Masahiko; Kakita, Akiyoshi; Wakabayashi, Koichi. Role of VAPB and vesicular profiles in α-synuclein aggregates in multiple system atrophy. Brain Pathology (Zurich, Switzerland). 2021;31(6):e13001.