Anti VAPA pAb (ATL-HPA009174 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009174-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: VAPA
Alternative Gene Name: hVAP-33, VAP-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024091: 60%, ENSRNOG00000014765: 84%
Entrez Gene ID: 9218
Uniprot ID: Q9P0L0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF |
| Gene Sequence | NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF |
| Gene ID - Mouse | ENSMUSG00000024091 |
| Gene ID - Rat | ENSRNOG00000014765 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) | |
| Datasheet | Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) | |
| Datasheet | Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) |
| Citations for Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) – 5 Found |
| Cianciola, Nicholas L; Chung, Stacey; Manor, Danny; Carlin, Cathleen R. Adenovirus Modulates Toll-Like Receptor 4 Signaling by Reprogramming ORP1L-VAP Protein Contacts for Cholesterol Transport from Endosomes to the Endoplasmic Reticulum. Journal Of Virology. 2017;91(6) PubMed |
| Tamura, Norito; Sakai, Shota; Martorell, Loreto; Colomé, Roser; Mizuike, Aya; Goto, Asako; Ortigoza-Escobar, Juan Darío; Hanada, Kentaro. Intellectual-disability-associated mutations in the ceramide transport protein gene CERT1 lead to aberrant function and subcellular distribution. The Journal Of Biological Chemistry. 2021;297(5):101338. PubMed |
| Shimasaki, Kentaro; Kumagai, Keigo; Sakai, Shota; Yamaji, Toshiyuki; Hanada, Kentaro. Hyperosmotic Stress Induces Phosphorylation of CERT and Enhances Its Tethering throughout the Endoplasmic Reticulum. International Journal Of Molecular Sciences. 2022;23(7) PubMed |
| Leca, Ines; Phillips, Alexander William; Hofer, Iris; Landler, Lukas; Ushakova, Lyubov; Cushion, Thomas David; Dürnberger, Gerhard; Stejskal, Karel; Mechtler, Karl; Keays, David Anthony. A proteomic survey of microtubule-associated proteins in a R402H TUBA1A mutant mouse. Plos Genetics. 2020;16(11):e1009104. PubMed |
| Murakami, Hiroaki; Tamura, Norito; Enomoto, Yumi; Shimasaki, Kentaro; Kurosawa, Kenji; Hanada, Kentaro. Intellectual disability-associated gain-of-function mutations in CERT1 that encodes the ceramide transport protein CERT. Plos One. 15(12):e0243980. PubMed |