Anti VAPA pAb (ATL-HPA009174 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA009174-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Gene Name: VAPA
Alternative Gene Name: hVAP-33, VAP-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024091: 60%, ENSRNOG00000014765: 84%
Entrez Gene ID: 9218
Uniprot ID: Q9P0L0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF
Gene Sequence NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF
Gene ID - Mouse ENSMUSG00000024091
Gene ID - Rat ENSRNOG00000014765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VAPA pAb (ATL-HPA009174 w/enhanced validation)
Datasheet Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VAPA pAb (ATL-HPA009174 w/enhanced validation)
Datasheet Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VAPA pAb (ATL-HPA009174 w/enhanced validation)
Citations for Anti VAPA pAb (ATL-HPA009174 w/enhanced validation) – 5 Found
Cianciola, Nicholas L; Chung, Stacey; Manor, Danny; Carlin, Cathleen R. Adenovirus Modulates Toll-Like Receptor 4 Signaling by Reprogramming ORP1L-VAP Protein Contacts for Cholesterol Transport from Endosomes to the Endoplasmic Reticulum. Journal Of Virology. 2017;91(6)  PubMed
Tamura, Norito; Sakai, Shota; Martorell, Loreto; Colomé, Roser; Mizuike, Aya; Goto, Asako; Ortigoza-Escobar, Juan Darío; Hanada, Kentaro. Intellectual-disability-associated mutations in the ceramide transport protein gene CERT1 lead to aberrant function and subcellular distribution. The Journal Of Biological Chemistry. 2021;297(5):101338.  PubMed
Shimasaki, Kentaro; Kumagai, Keigo; Sakai, Shota; Yamaji, Toshiyuki; Hanada, Kentaro. Hyperosmotic Stress Induces Phosphorylation of CERT and Enhances Its Tethering throughout the Endoplasmic Reticulum. International Journal Of Molecular Sciences. 2022;23(7)  PubMed
Leca, Ines; Phillips, Alexander William; Hofer, Iris; Landler, Lukas; Ushakova, Lyubov; Cushion, Thomas David; Dürnberger, Gerhard; Stejskal, Karel; Mechtler, Karl; Keays, David Anthony. A proteomic survey of microtubule-associated proteins in a R402H TUBA1A mutant mouse. Plos Genetics. 2020;16(11):e1009104.  PubMed
Murakami, Hiroaki; Tamura, Norito; Enomoto, Yumi; Shimasaki, Kentaro; Kurosawa, Kenji; Hanada, Kentaro. Intellectual disability-associated gain-of-function mutations in CERT1 that encodes the ceramide transport protein CERT. Plos One. 15(12):e0243980.  PubMed