Anti VANGL2 pAb (ATL-HPA027043)

Atlas Antibodies

Catalog No.: ATL-HPA027043-25

Protein Description: VANGL planar cell polarity protein 2
Gene Name: VANGL2
Alternative Gene Name: KIAA1215, LPP1, LTAP, MGC119403, MGC119404, STB1, STBM, STBM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026556: 100%, ENSRNOG00000004889: 100%
Entrez Gene ID: 57216
Uniprot ID: Q9ULK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRV
• Gene Sequence: QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRV
• Gene ID - Mouse: ENSMUSG00000026556
• Gene ID - Rat: ENSRNOG00000004889
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VANGL2 pAb (ATL-HPA027043) – 3 Found

Tao, Hirotaka; Zhu, Min; Lau, Kimberly; Whitley, Owen K W; Samani, Mohammad; Xiao, Xiao; Chen, Xiao Xiao; Hahn, Noah A; Liu, Weifan; Valencia, Megan; Wu, Min; Wang, Xian; Fenelon, Kelli D; Pasiliao, Clarissa C; Hu, Di; Wu, Jinchun; Spring, Shoshana; Ferguson, James; Karuna, Edith P; Henkelman, R Mark; Dunn, Alexander; Huang, Huaxiong; Ho, Hsin-Yi Henry; Atit, Radhika; Goyal, Sidhartha; Sun, Yu; Hopyan, Sevan. Oscillatory cortical forces promote three dimensional cell intercalations that shape the murine mandibular arch. Nature Communications. 2019;10(1):1703. 

Chen, Haiqi; Mruk, Dolores D; Lee, Will M; Cheng, C Yan. Planar Cell Polarity (PCP) Protein Vangl2 Regulates Ectoplasmic Specialization Dynamics via Its Effects on Actin Microfilaments in the Testes of Male Rats. Endocrinology. 2016;157(5):2140-59. 

Wilson, D H; Jarman, E J; Mellin, R P; Wilson, M L; Waddell, S H; Tsokkou, P; Younger, N T; Raven, A; Bhalla, S R; Noll, A T R; Olde Damink, S W; Schaap, F G; Chen, P; Bates, D O; Banales, J M; Dean, C H; Henderson, D J; Sansom, O J; Kendall, T J; Boulter, L. Non-canonical Wnt signalling regulates scarring in biliary disease via the planar cell polarity receptors. Nature Communications. 2020;11(1):445.