Anti VANGL1 pAb (ATL-HPA025235 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025235-25

Protein Description: VANGL planar cell polarity protein 1
Gene Name: VANGL1
Alternative Gene Name: STB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027860: 95%, ENSRNOG00000016477: 95%
Entrez Gene ID: 81839
Uniprot ID: Q8TAA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
• Gene Sequence: DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
• Gene ID - Mouse: ENSMUSG00000027860
• Gene ID - Rat: ENSRNOG00000016477
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VANGL1 pAb (ATL-HPA025235 w/enhanced validation) – 16 Found

Kunimoto, Koshi; Bayly, Roy D; Vladar, Eszter K; Vonderfecht, Tyson; Gallagher, Anna-Rachel; Axelrod, Jeffrey D. Disruption of Core Planar Cell Polarity Signaling Regulates Renal Tubule Morphogenesis but Is Not Cystogenic. Current Biology : Cb. 2017;27(20):3120-3131.e4. 

Tsuji, Takuya; Nakamura, Ryosuke; Katsuno, Tatsuya; Kishimoto, Yo; Suehiro, Atsushi; Yamashita, Masaru; Uozumi, Ryuji; Nakamura, Tatsuo; Tateya, Ichiro; Omori, Koichi. Long-term preservation of planar cell polarity in reversed tracheal epithelium. Respiratory Research. 2018;19(1):22. 

Stoller, Michelle L; Roman, Orvelin Jr; Deans, Michael R. Domineering non-autonomy in Vangl1;Vangl2 double mutants demonstrates intercellular PCP signaling in the vertebrate inner ear. Developmental Biology. 2018;437(1):17-26. 

Dai, D; Li, L; Huebner, A; Zeng, H; Guevara, E; Claypool, D J; Liu, A; Chen, J. Planar cell polarity effector gene Intu regulates cell fate-specific differentiation of keratinocytes through the primary cilia. Cell Death And Differentiation. 2013;20(1):130-8. 

Copley, Catherine O; Duncan, Jeremy S; Liu, Chang; Cheng, Haixia; Deans, Michael R. Postnatal refinement of auditory hair cell planar polarity deficits occurs in the absence of Vangl2. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2013;33(35):14001-16. 

Gegg, Moritz; Böttcher, Anika; Burtscher, Ingo; Hasenoeder, Stefan; Van Campenhout, Claude; Aichler, Michaela; Walch, Axel; Grant, Seth G N; Lickert, Heiko. Flattop regulates basal body docking and positioning in mono- and multiciliated cells. Elife. 2014;3( 25296022) 

Vladar, Eszter K; Lee, Yin Loon; Stearns, Tim; Axelrod, Jeffrey D. Observing planar cell polarity in multiciliated mouse airway epithelial cells. Methods In Cell Biology. 127( 25837385):37-54. 

Hirashima, Tsuyoshi; Adachi, Taiji. Polarized cellular mechano-response system for maintaining radial size in developing epithelial tubes. Development (Cambridge, England). 2019;146(23) 

Chivukula, Raghu R; Montoro, Daniel T; Leung, Hui Min; Yang, Jason; Shamseldin, Hanan E; Taylor, Martin S; Dougherty, Gerard W; Zariwala, Maimoona A; Carson, Johnny; Daniels, M Leigh Anne; Sears, Patrick R; Black, Katharine E; Hariri, Lida P; Almogarri, Ibrahim; Frenkel, Evgeni M; Vinarsky, Vladimir; Omran, Heymut; Knowles, Michael R; Tearney, Guillermo J; Alkuraya, Fowzan S; Sabatini, David M. A human ciliopathy reveals essential functions for NEK10 in airway mucociliary clearance. Nature Medicine. 2020;26(2):244-251. 

Wilson, D H; Jarman, E J; Mellin, R P; Wilson, M L; Waddell, S H; Tsokkou, P; Younger, N T; Raven, A; Bhalla, S R; Noll, A T R; Olde Damink, S W; Schaap, F G; Chen, P; Bates, D O; Banales, J M; Dean, C H; Henderson, D J; Sansom, O J; Kendall, T J; Boulter, L. Non-canonical Wnt signalling regulates scarring in biliary disease via the planar cell polarity receptors. Nature Communications. 2020;11(1):445. 

Ryu, Hyunchul; Lee, Haeryung; Lee, Jiyeon; Noh, Hyuna; Shin, Miram; Kumar, Vijay; Hong, Sejeong; Kim, Jaebong; Park, Soochul. The molecular dynamics of subdistal appendages in multi-ciliated cells. Nature Communications. 2021;12(1):612. 

Mikhailik, Anatoly; Michurina, Tatyana V; Dikranian, Krikor; Hearn, Stephen; Maxakov, Vladimir I; Siller, Saul S; Takemaru, Ken-Ichi; Enikolopov, Grigori; Peunova, Natalia. nNOS regulates ciliated cell polarity, ciliary beat frequency, and directional flow in mouse trachea. Life Science Alliance. 2021;4(5) 

Nakayama, Shogo; Yano, Tomoki; Namba, Toshinori; Konishi, Satoshi; Takagishi, Maki; Herawati, Elisa; Nishida, Tomoki; Imoto, Yasuo; Ishihara, Shuji; Takahashi, Masahide; Furuta, Ken'ya; Oiwa, Kazuhiro; Tamura, Atsushi; Tsukita, Sachiko. Planar cell polarity induces local microtubule bundling for coordinated ciliary beating. The Journal Of Cell Biology. 2021;220(7) 

Mateos-Quiros, Clara Maria; Garrido-Jimenez, Sergio; Álvarez-Hernán, Guadalupe; Diaz-Chamorro, Selene; Barrera-Lopez, Juan Francisco; Francisco-Morcillo, Javier; Roman, Angel Carlos; Centeno, Francisco; Carvajal-Gonzalez, Jose Maria. Junctional Adhesion Molecule 3 Expression in the Mouse Airway Epithelium Is Linked to Multiciliated Cells. Frontiers In Cell And Developmental Biology. 9( 34395412):622515. 

Basta, Lena P; Hill-Oliva, Michael; Paramore, Sarah V; Sharan, Rishabh; Goh, Audrey; Biswas, Abhishek; Cortez, Marvin; Little, Katherine A; Posfai, Eszter; Devenport, Danelle. New mouse models for high resolution and live imaging of planar cell polarity proteins in vivo. Development (Cambridge, England). 2021;148(18) 

Juan, Guillermina R Ramirez-San; Mathijssen, Arnold J T M; He, Mu; Jan, Lily; Marshall, Wallace; Prakash, Manu. Multi-scale spatial heterogeneity enhances particle clearance in airway ciliary arrays. Nature Physics. 2020;16(9):958-964.