Anti UVSSA pAb (ATL-HPA050824)

Atlas Antibodies

Catalog No.:
ATL-HPA050824-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: UV-stimulated scaffold protein A
Gene Name: UVSSA
Alternative Gene Name: KIAA1530
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037355: 81%, ENSRNOG00000005122: 81%
Entrez Gene ID: 57654
Uniprot ID: Q2YD98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLK
Gene Sequence PQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLK
Gene ID - Mouse ENSMUSG00000037355
Gene ID - Rat ENSRNOG00000005122
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UVSSA pAb (ATL-HPA050824)
Datasheet Anti UVSSA pAb (ATL-HPA050824) Datasheet (External Link)
Vendor Page Anti UVSSA pAb (ATL-HPA050824) at Atlas Antibodies

Documents & Links for Anti UVSSA pAb (ATL-HPA050824)
Datasheet Anti UVSSA pAb (ATL-HPA050824) Datasheet (External Link)
Vendor Page Anti UVSSA pAb (ATL-HPA050824)