Anti UVSSA pAb (ATL-HPA050824)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050824-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UVSSA
Alternative Gene Name: KIAA1530
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037355: 81%, ENSRNOG00000005122: 81%
Entrez Gene ID: 57654
Uniprot ID: Q2YD98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLK |
| Gene Sequence | PQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLK |
| Gene ID - Mouse | ENSMUSG00000037355 |
| Gene ID - Rat | ENSRNOG00000005122 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UVSSA pAb (ATL-HPA050824) | |
| Datasheet | Anti UVSSA pAb (ATL-HPA050824) Datasheet (External Link) |
| Vendor Page | Anti UVSSA pAb (ATL-HPA050824) at Atlas Antibodies |
| Documents & Links for Anti UVSSA pAb (ATL-HPA050824) | |
| Datasheet | Anti UVSSA pAb (ATL-HPA050824) Datasheet (External Link) |
| Vendor Page | Anti UVSSA pAb (ATL-HPA050824) |