Anti UTP20 pAb (ATL-HPA049341)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049341-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UTP20
Alternative Gene Name: 1A6/DRIM, DRIM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004356: 81%, ENSRNOG00000005823: 81%
Entrez Gene ID: 27340
Uniprot ID: O75691
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC |
| Gene Sequence | FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC |
| Gene ID - Mouse | ENSMUSG00000004356 |
| Gene ID - Rat | ENSRNOG00000005823 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UTP20 pAb (ATL-HPA049341) | |
| Datasheet | Anti UTP20 pAb (ATL-HPA049341) Datasheet (External Link) |
| Vendor Page | Anti UTP20 pAb (ATL-HPA049341) at Atlas Antibodies |
| Documents & Links for Anti UTP20 pAb (ATL-HPA049341) | |
| Datasheet | Anti UTP20 pAb (ATL-HPA049341) Datasheet (External Link) |
| Vendor Page | Anti UTP20 pAb (ATL-HPA049341) |