Anti UTP20 pAb (ATL-HPA049341)

Atlas Antibodies

Catalog No.: ATL-HPA049341-25

Protein Description: UTP20 small subunit (SSU) processome component
Gene Name: UTP20
Alternative Gene Name: 1A6/DRIM, DRIM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004356: 81%, ENSRNOG00000005823: 81%
Entrez Gene ID: 27340
Uniprot ID: O75691
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
• Gene Sequence: FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
• Gene ID - Mouse: ENSMUSG00000004356
• Gene ID - Rat: ENSRNOG00000005823
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.