Anti USP53 pAb (ATL-HPA035844)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035844-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: USP53
Alternative Gene Name: KIAA1350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039701: 67%, ENSRNOG00000014660: 66%
Entrez Gene ID: 54532
Uniprot ID: Q70EK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | APNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNR |
| Gene Sequence | APNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNR |
| Gene ID - Mouse | ENSMUSG00000039701 |
| Gene ID - Rat | ENSRNOG00000014660 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti USP53 pAb (ATL-HPA035844) | |
| Datasheet | Anti USP53 pAb (ATL-HPA035844) Datasheet (External Link) |
| Vendor Page | Anti USP53 pAb (ATL-HPA035844) at Atlas Antibodies |
| Documents & Links for Anti USP53 pAb (ATL-HPA035844) | |
| Datasheet | Anti USP53 pAb (ATL-HPA035844) Datasheet (External Link) |
| Vendor Page | Anti USP53 pAb (ATL-HPA035844) |
| Citations for Anti USP53 pAb (ATL-HPA035844) – 1 Found |
| Kazmierczak, Marcin; Harris, Suzan L; Kazmierczak, Piotr; Shah, Prahar; Starovoytov, Valentin; Ohlemiller, Kevin K; Schwander, Martin. Progressive Hearing Loss in Mice Carrying a Mutation in Usp53. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2015;35(47):15582-98. PubMed |