Anti USP53 pAb (ATL-HPA035844)

Atlas Antibodies

Catalog No.:
ATL-HPA035844-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 53
Gene Name: USP53
Alternative Gene Name: KIAA1350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039701: 67%, ENSRNOG00000014660: 66%
Entrez Gene ID: 54532
Uniprot ID: Q70EK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNR
Gene Sequence APNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNR
Gene ID - Mouse ENSMUSG00000039701
Gene ID - Rat ENSRNOG00000014660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP53 pAb (ATL-HPA035844)
Datasheet Anti USP53 pAb (ATL-HPA035844) Datasheet (External Link)
Vendor Page Anti USP53 pAb (ATL-HPA035844) at Atlas Antibodies

Documents & Links for Anti USP53 pAb (ATL-HPA035844)
Datasheet Anti USP53 pAb (ATL-HPA035844) Datasheet (External Link)
Vendor Page Anti USP53 pAb (ATL-HPA035844)
Citations for Anti USP53 pAb (ATL-HPA035844) – 1 Found
Kazmierczak, Marcin; Harris, Suzan L; Kazmierczak, Piotr; Shah, Prahar; Starovoytov, Valentin; Ohlemiller, Kevin K; Schwander, Martin. Progressive Hearing Loss in Mice Carrying a Mutation in Usp53. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2015;35(47):15582-98.  PubMed