Anti USP5 pAb (ATL-HPA006756)

Atlas Antibodies

Catalog No.:
ATL-HPA006756-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 5 (isopeptidase T)
Gene Name: USP5
Alternative Gene Name: IsoT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038429: 97%, ENSRNOG00000015409: 97%
Entrez Gene ID: 8078
Uniprot ID: P45974
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen YVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVF
Gene Sequence YVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVF
Gene ID - Mouse ENSMUSG00000038429
Gene ID - Rat ENSRNOG00000015409
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP5 pAb (ATL-HPA006756)
Datasheet Anti USP5 pAb (ATL-HPA006756) Datasheet (External Link)
Vendor Page Anti USP5 pAb (ATL-HPA006756) at Atlas Antibodies

Documents & Links for Anti USP5 pAb (ATL-HPA006756)
Datasheet Anti USP5 pAb (ATL-HPA006756) Datasheet (External Link)
Vendor Page Anti USP5 pAb (ATL-HPA006756)