Anti USP43 pAb (ATL-HPA023389)

Atlas Antibodies

Catalog No.:
ATL-HPA023389-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 43
Gene Name: USP43
Alternative Gene Name: FLJ30626
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020905: 59%, ENSRNOG00000003785: 57%
Entrez Gene ID: 124739
Uniprot ID: Q70EL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNVALPANSEDGGRAIERGPAGVPCPSAQPNHCLAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKSSPPSPYMGFSGNSK
Gene Sequence SNVALPANSEDGGRAIERGPAGVPCPSAQPNHCLAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKSSPPSPYMGFSGNSK
Gene ID - Mouse ENSMUSG00000020905
Gene ID - Rat ENSRNOG00000003785
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP43 pAb (ATL-HPA023389)
Datasheet Anti USP43 pAb (ATL-HPA023389) Datasheet (External Link)
Vendor Page Anti USP43 pAb (ATL-HPA023389) at Atlas Antibodies

Documents & Links for Anti USP43 pAb (ATL-HPA023389)
Datasheet Anti USP43 pAb (ATL-HPA023389) Datasheet (External Link)
Vendor Page Anti USP43 pAb (ATL-HPA023389)