Anti USP38 pAb (ATL-HPA036990)

Atlas Antibodies

Catalog No.: ATL-HPA036990-25

Protein Description: ubiquitin specific peptidase 38
Gene Name: USP38
Alternative Gene Name: HP43.8KD, KIAA1891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038250: 98%, ENSRNOG00000026880: 99%
Entrez Gene ID: 84640
Uniprot ID: Q8NB14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEHWLDEAQCEAMFDLTTRLILEGQDPFQRQVGHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPS
• Gene Sequence: AEHWLDEAQCEAMFDLTTRLILEGQDPFQRQVGHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPS
• Gene ID - Mouse: ENSMUSG00000038250
• Gene ID - Rat: ENSRNOG00000026880
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.