Anti USP22 pAb (ATL-HPA044980)

Atlas Antibodies

Catalog No.:
ATL-HPA044980-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 22
Gene Name: USP22
Alternative Gene Name: KIAA1063, USP3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042506: 93%, ENSRNOG00000032492: 96%
Entrez Gene ID: 23326
Uniprot ID: Q9UPT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF
Gene Sequence MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF
Gene ID - Mouse ENSMUSG00000042506
Gene ID - Rat ENSRNOG00000032492
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP22 pAb (ATL-HPA044980)
Datasheet Anti USP22 pAb (ATL-HPA044980) Datasheet (External Link)
Vendor Page Anti USP22 pAb (ATL-HPA044980) at Atlas Antibodies

Documents & Links for Anti USP22 pAb (ATL-HPA044980)
Datasheet Anti USP22 pAb (ATL-HPA044980) Datasheet (External Link)
Vendor Page Anti USP22 pAb (ATL-HPA044980)
Citations for Anti USP22 pAb (ATL-HPA044980) – 1 Found
Gennaro, Victoria J; Stanek, Timothy J; Peck, Amy R; Sun, Yunguang; Wang, Feng; Qie, Shuo; Knudsen, Karen E; Rui, Hallgeir; Butt, Tauseef; Diehl, J Alan; McMahon, Steven B. Control of CCND1 ubiquitylation by the catalytic SAGA subunit USP22 is essential for cell cycle progression through G1 in cancer cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(40):E9298-E9307.  PubMed