Anti USP22 pAb (ATL-HPA044980)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044980-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: USP22
Alternative Gene Name: KIAA1063, USP3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042506: 93%, ENSRNOG00000032492: 96%
Entrez Gene ID: 23326
Uniprot ID: Q9UPT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF |
Gene Sequence | MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF |
Gene ID - Mouse | ENSMUSG00000042506 |
Gene ID - Rat | ENSRNOG00000032492 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti USP22 pAb (ATL-HPA044980) | |
Datasheet | Anti USP22 pAb (ATL-HPA044980) Datasheet (External Link) |
Vendor Page | Anti USP22 pAb (ATL-HPA044980) at Atlas Antibodies |
Documents & Links for Anti USP22 pAb (ATL-HPA044980) | |
Datasheet | Anti USP22 pAb (ATL-HPA044980) Datasheet (External Link) |
Vendor Page | Anti USP22 pAb (ATL-HPA044980) |
Citations for Anti USP22 pAb (ATL-HPA044980) – 1 Found |
Gennaro, Victoria J; Stanek, Timothy J; Peck, Amy R; Sun, Yunguang; Wang, Feng; Qie, Shuo; Knudsen, Karen E; Rui, Hallgeir; Butt, Tauseef; Diehl, J Alan; McMahon, Steven B. Control of CCND1 ubiquitylation by the catalytic SAGA subunit USP22 is essential for cell cycle progression through G1 in cancer cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(40):E9298-E9307. PubMed |