Anti USF1 pAb (ATL-HPA036535)

Atlas Antibodies

Catalog No.:
ATL-HPA036535-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: upstream transcription factor 1
Gene Name: USF1
Alternative Gene Name: bHLHb11, MLTFI, UEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026641: 99%, ENSRNOG00000004255: 97%
Entrez Gene ID: 7391
Uniprot ID: P22415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDT
Gene Sequence IQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDT
Gene ID - Mouse ENSMUSG00000026641
Gene ID - Rat ENSRNOG00000004255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USF1 pAb (ATL-HPA036535)
Datasheet Anti USF1 pAb (ATL-HPA036535) Datasheet (External Link)
Vendor Page Anti USF1 pAb (ATL-HPA036535) at Atlas Antibodies

Documents & Links for Anti USF1 pAb (ATL-HPA036535)
Datasheet Anti USF1 pAb (ATL-HPA036535) Datasheet (External Link)
Vendor Page Anti USF1 pAb (ATL-HPA036535)