Anti USE1 pAb (ATL-HPA047562)

Atlas Antibodies

Catalog No.:
ATL-HPA047562-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: unconventional SNARE in the ER 1 homolog (S. cerevisiae)
Gene Name: USE1
Alternative Gene Name: MDS032, p31, SLT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002395: 94%, ENSRNOG00000016619: 94%
Entrez Gene ID: 55850
Uniprot ID: Q9NZ43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHL
Gene Sequence SRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHL
Gene ID - Mouse ENSMUSG00000002395
Gene ID - Rat ENSRNOG00000016619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USE1 pAb (ATL-HPA047562)
Datasheet Anti USE1 pAb (ATL-HPA047562) Datasheet (External Link)
Vendor Page Anti USE1 pAb (ATL-HPA047562) at Atlas Antibodies

Documents & Links for Anti USE1 pAb (ATL-HPA047562)
Datasheet Anti USE1 pAb (ATL-HPA047562) Datasheet (External Link)
Vendor Page Anti USE1 pAb (ATL-HPA047562)
Citations for Anti USE1 pAb (ATL-HPA047562) – 1 Found
Xu, Dijin; Li, Yuqi; Wu, Lizhen; Li, Ying; Zhao, Dongyu; Yu, Jinhai; Huang, Tuozhi; Ferguson, Charles; Parton, Robert G; Yang, Hongyuan; Li, Peng. Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions. The Journal Of Cell Biology. 2018;217(3):975-995.  PubMed