Anti URB1 pAb (ATL-HPA018334)

Atlas Antibodies

Catalog No.:
ATL-HPA018334-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: URB1 ribosome biogenesis 1 homolog (S. cerevisiae)
Gene Name: URB1
Alternative Gene Name: C21orf108, KIAA0539, NPA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039929: 88%, ENSRNOG00000002080: 87%
Entrez Gene ID: 9875
Uniprot ID: O60287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEHHKTCRSLGRSLWQQPSVGDILRLLDRDRMMQTILHFPQNRRLLPPEDTQELIFKDKSRVDLDGLYDPCFLLQLFSELTRPEFVVDCRKFLDSNALGLTVTALSSYDP
Gene Sequence VEHHKTCRSLGRSLWQQPSVGDILRLLDRDRMMQTILHFPQNRRLLPPEDTQELIFKDKSRVDLDGLYDPCFLLQLFSELTRPEFVVDCRKFLDSNALGLTVTALSSYDP
Gene ID - Mouse ENSMUSG00000039929
Gene ID - Rat ENSRNOG00000002080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti URB1 pAb (ATL-HPA018334)
Datasheet Anti URB1 pAb (ATL-HPA018334) Datasheet (External Link)
Vendor Page Anti URB1 pAb (ATL-HPA018334) at Atlas Antibodies

Documents & Links for Anti URB1 pAb (ATL-HPA018334)
Datasheet Anti URB1 pAb (ATL-HPA018334) Datasheet (External Link)
Vendor Page Anti URB1 pAb (ATL-HPA018334)