Anti UQCRQ pAb (ATL-HPA046693)

Atlas Antibodies

Catalog No.:
ATL-HPA046693-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
Gene Name: UQCRQ
Alternative Gene Name: QCR8, QP-C, UQCR7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044894: 85%, ENSRNOG00000048174: 90%
Entrez Gene ID: 27089
Uniprot ID: O14949
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR
Gene Sequence REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR
Gene ID - Mouse ENSMUSG00000044894
Gene ID - Rat ENSRNOG00000048174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UQCRQ pAb (ATL-HPA046693)
Datasheet Anti UQCRQ pAb (ATL-HPA046693) Datasheet (External Link)
Vendor Page Anti UQCRQ pAb (ATL-HPA046693) at Atlas Antibodies

Documents & Links for Anti UQCRQ pAb (ATL-HPA046693)
Datasheet Anti UQCRQ pAb (ATL-HPA046693) Datasheet (External Link)
Vendor Page Anti UQCRQ pAb (ATL-HPA046693)
Citations for Anti UQCRQ pAb (ATL-HPA046693) – 1 Found
Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56.  PubMed