Anti UPK3B pAb (ATL-HPA010506)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010506-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: UPK3B
Alternative Gene Name: FLJ32198, MGC10902, p35, UPIIIb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042985: 77%, ENSRNOG00000023686: 81%
Entrez Gene ID: 105375355
Uniprot ID: Q9BT76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA |
| Gene Sequence | ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA |
| Gene ID - Mouse | ENSMUSG00000042985 |
| Gene ID - Rat | ENSRNOG00000023686 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UPK3B pAb (ATL-HPA010506) | |
| Datasheet | Anti UPK3B pAb (ATL-HPA010506) Datasheet (External Link) |
| Vendor Page | Anti UPK3B pAb (ATL-HPA010506) at Atlas Antibodies |
| Documents & Links for Anti UPK3B pAb (ATL-HPA010506) | |
| Datasheet | Anti UPK3B pAb (ATL-HPA010506) Datasheet (External Link) |
| Vendor Page | Anti UPK3B pAb (ATL-HPA010506) |