Anti UPK3B pAb (ATL-HPA010506)

Atlas Antibodies

Catalog No.:
ATL-HPA010506-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: uroplakin 3B
Gene Name: UPK3B
Alternative Gene Name: FLJ32198, MGC10902, p35, UPIIIb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042985: 77%, ENSRNOG00000023686: 81%
Entrez Gene ID: 105375355
Uniprot ID: Q9BT76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA
Gene Sequence ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA
Gene ID - Mouse ENSMUSG00000042985
Gene ID - Rat ENSRNOG00000023686
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UPK3B pAb (ATL-HPA010506)
Datasheet Anti UPK3B pAb (ATL-HPA010506) Datasheet (External Link)
Vendor Page Anti UPK3B pAb (ATL-HPA010506) at Atlas Antibodies

Documents & Links for Anti UPK3B pAb (ATL-HPA010506)
Datasheet Anti UPK3B pAb (ATL-HPA010506) Datasheet (External Link)
Vendor Page Anti UPK3B pAb (ATL-HPA010506)