Anti UPK1B pAb (ATL-HPA031800)

Atlas Antibodies

Catalog No.:
ATL-HPA031800-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: uroplakin 1B
Gene Name: UPK1B
Alternative Gene Name: TSPAN20, UPK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049436: 88%, ENSRNOG00000027380: 85%
Entrez Gene ID: 7348
Uniprot ID: O75841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
Gene Sequence KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
Gene ID - Mouse ENSMUSG00000049436
Gene ID - Rat ENSRNOG00000027380
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UPK1B pAb (ATL-HPA031800)
Datasheet Anti UPK1B pAb (ATL-HPA031800) Datasheet (External Link)
Vendor Page Anti UPK1B pAb (ATL-HPA031800) at Atlas Antibodies

Documents & Links for Anti UPK1B pAb (ATL-HPA031800)
Datasheet Anti UPK1B pAb (ATL-HPA031800) Datasheet (External Link)
Vendor Page Anti UPK1B pAb (ATL-HPA031800)
Citations for Anti UPK1B pAb (ATL-HPA031800) – 1 Found
Dhondt, Bert; Geeurickx, Edward; Tulkens, Joeri; Van Deun, Jan; Vergauwen, Glenn; Lippens, Lien; Miinalainen, Ilkka; Rappu, Pekka; Heino, Jyrki; Ost, Piet; Lumen, Nicolaas; De Wever, Olivier; Hendrix, An. Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. Journal Of Extracellular Vesicles. 9(1):1736935.  PubMed