Anti UPK1B pAb (ATL-HPA031800)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031800-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: UPK1B
Alternative Gene Name: TSPAN20, UPK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049436: 88%, ENSRNOG00000027380: 85%
Entrez Gene ID: 7348
Uniprot ID: O75841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR |
| Gene Sequence | KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR |
| Gene ID - Mouse | ENSMUSG00000049436 |
| Gene ID - Rat | ENSRNOG00000027380 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UPK1B pAb (ATL-HPA031800) | |
| Datasheet | Anti UPK1B pAb (ATL-HPA031800) Datasheet (External Link) |
| Vendor Page | Anti UPK1B pAb (ATL-HPA031800) at Atlas Antibodies |
| Documents & Links for Anti UPK1B pAb (ATL-HPA031800) | |
| Datasheet | Anti UPK1B pAb (ATL-HPA031800) Datasheet (External Link) |
| Vendor Page | Anti UPK1B pAb (ATL-HPA031800) |
| Citations for Anti UPK1B pAb (ATL-HPA031800) – 1 Found |
| Dhondt, Bert; Geeurickx, Edward; Tulkens, Joeri; Van Deun, Jan; Vergauwen, Glenn; Lippens, Lien; Miinalainen, Ilkka; Rappu, Pekka; Heino, Jyrki; Ost, Piet; Lumen, Nicolaas; De Wever, Olivier; Hendrix, An. Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. Journal Of Extracellular Vesicles. 9(1):1736935. PubMed |