Anti UNC13B pAb (ATL-HPA024493)

Atlas Antibodies

Catalog No.:
ATL-HPA024493-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: unc-13 homolog B (C. elegans)
Gene Name: UNC13B
Alternative Gene Name: hmunc13, UNC13, Unc13h2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028456: 74%, ENSRNOG00000008237: 69%
Entrez Gene ID: 10497
Uniprot ID: O14795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQLSELDQYHEQDDDHRETDSIHSCHSSHSLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPP
Gene Sequence SQLSELDQYHEQDDDHRETDSIHSCHSSHSLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPP
Gene ID - Mouse ENSMUSG00000028456
Gene ID - Rat ENSRNOG00000008237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UNC13B pAb (ATL-HPA024493)
Datasheet Anti UNC13B pAb (ATL-HPA024493) Datasheet (External Link)
Vendor Page Anti UNC13B pAb (ATL-HPA024493) at Atlas Antibodies

Documents & Links for Anti UNC13B pAb (ATL-HPA024493)
Datasheet Anti UNC13B pAb (ATL-HPA024493) Datasheet (External Link)
Vendor Page Anti UNC13B pAb (ATL-HPA024493)