Anti UMPS pAb (ATL-HPA036179)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036179-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UMPS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022814: 91%, ENSRNOG00000001797: 91%
Entrez Gene ID: 7372
Uniprot ID: P11172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVL |
| Gene Sequence | RLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVL |
| Gene ID - Mouse | ENSMUSG00000022814 |
| Gene ID - Rat | ENSRNOG00000001797 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UMPS pAb (ATL-HPA036179) | |
| Datasheet | Anti UMPS pAb (ATL-HPA036179) Datasheet (External Link) |
| Vendor Page | Anti UMPS pAb (ATL-HPA036179) at Atlas Antibodies |
| Documents & Links for Anti UMPS pAb (ATL-HPA036179) | |
| Datasheet | Anti UMPS pAb (ATL-HPA036179) Datasheet (External Link) |
| Vendor Page | Anti UMPS pAb (ATL-HPA036179) |