Anti UMPS pAb (ATL-HPA036178 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036178-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: uridine monophosphate synthetase
Gene Name: UMPS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022814: 81%, ENSRNOG00000001797: 85%
Entrez Gene ID: 7372
Uniprot ID: P11172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNASPLSIKEAPKELSFGARAELPRIHPVA
Gene Sequence GLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNASPLSIKEAPKELSFGARAELPRIHPVA
Gene ID - Mouse ENSMUSG00000022814
Gene ID - Rat ENSRNOG00000001797
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UMPS pAb (ATL-HPA036178 w/enhanced validation)
Datasheet Anti UMPS pAb (ATL-HPA036178 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UMPS pAb (ATL-HPA036178 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UMPS pAb (ATL-HPA036178 w/enhanced validation)
Datasheet Anti UMPS pAb (ATL-HPA036178 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UMPS pAb (ATL-HPA036178 w/enhanced validation)